PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P02550_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 392aa    MW: 44801.5 Da    PI: 6.7912
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P02550_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS84.41.9e-261752751104
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++lL++cA+av+++d + a++lL+++++++s +gd++qRla+ f+ +L+arla+++s++y++l +++++   +++ l+a++l+  ++
  GSMUA_Achr8P02550_001 175 LRTLLIHCAQAVATDDRRSANELLKQIRQHSSRHGDANQRLAHWFADGLQARLAGTGSQVYQSLVAKRSP---VTDILKAYQLYLAAC 259
                            6789****************************************************************99...*************** PP

                   GRAS  89 PilkfshltaNqaIle 104
                            P+ k+sh+   q+Il+
  GSMUA_Achr8P02550_001 260 PFKKISHFFSTQTILN 275
                            **************97 PP

2GRAS56.55.9e-18309387296374
                   GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            n+    g+er+er et+++W+ r  +aGF+++pl+ +++k+ak  ++ ++ + + ++e+ ++l++gWk+r ++++S W+
  GSMUA_Achr8P02550_001 309 NLMDETGTERVERPETYKQWHVRNLRAGFTQLPLKPDIVKKAKDRVKSCYHKDFDMDEDGQWLLQGWKGRIIYALSTWK 387
                            778889********************************************889*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098519.089149392IPR005202Transcription factor GRAS
PfamPF035146.5E-24175275IPR005202Transcription factor GRAS
PfamPF035142.0E-15309387IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MEENIDEKFD VYPEDPALIA AEKPFYEILG EKFPPSPDRP PLCSSHFSDS PDDSISNHQG  60
NSWVEESLLS TLTPLDLLTE SQPAWQFQRG LEEARKFLPS EDKLVIDLEA SGFNIPQGMV  120
GVKQEDEDRE HQSVDKLRQK LQNEVSKLSH SCHSKGSSGG KGRGKKQSKR EVVDLRTLLI  180
HCAQAVATDD RRSANELLKQ IRQHSSRHGD ANQRLAHWFA DGLQARLAGT GSQVYQSLVA  240
KRSPVTDILK AYQLYLAACP FKKISHFFST QTILNLRMTG IDWETIRVED LNIREDEVVV  300
VNCLYRFRNL MDETGTERVE RPETYKQWHV RNLRAGFTQL PLKPDIVKKA KDRVKSCYHK  360
DFDMDEDGQW LLQGWKGRII YALSTWKSSS SC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412555.11e-178PREDICTED: scarecrow-like protein 33
RefseqXP_009412556.11e-178PREDICTED: scarecrow-like protein 33
RefseqXP_009412557.11e-178PREDICTED: scarecrow-like protein 33
RefseqXP_009412558.11e-178PREDICTED: scarecrow-like protein 33
RefseqXP_009412559.11e-178PREDICTED: scarecrow-like protein 33
TrEMBLM0TM070.0M0TM07_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P02550_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.12e-44GRAS family protein